PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00068.1.g00690.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 175aa    MW: 19238.6 Da    PI: 6.7903
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00068.1.g00690.1.sm.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like86.82.1e-271867251
                       G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51
                                  pr+rWt+eLH++Fveave LGG+++AtPk+il+lm+v+g++++h+kSHLQ
  Zjn_sc00068.1.g00690.1.sm.mk 18 PRMRWTEELHRQFVEAVECLGGKDEATPKRILQLMGVDGVSISHIKSHLQ 67
                                  8************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.9E-251467IPR009057Homeodomain-like
PROSITE profilePS5129411.3841474IPR017930Myb domain
SuperFamilySSF466891.08E-141867IPR009057Homeodomain-like
TIGRFAMsTIGR015573.8E-221867IPR006447Myb domain, plants
PfamPF002494.3E-81967IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 175 aa     Download sequence    Send to blast
MRYFERKGVR QYNRSEVPRM RWTEELHRQF VEAVECLGGK DEATPKRILQ LMGVDGVSIS  60
HIKSHLQYPS GKQLPQVDIN RSEQQQAIRP NNNSFSKKPA EKQKGCDLTL SIGMWPEDAN  120
SDADGSSTIS EELAAPPAGA EPFGSPAAGG RFAAVKQESA PALNLDLTIS SSWLA
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU4067639e-70CU406763.1 Oryza rufipogon (W1943) cDNA clone: ORW1943C005B16, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004966301.13e-39PREDICTED: uncharacterized protein LOC101769616
TrEMBLT1MM381e-50T1MM38_TRIUA; Uncharacterized protein
STRINGSi007179m1e-38(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP54933758
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02060.12e-23G2-like family protein